Our review
Automates the complete protein structure prediction workflow via Boltz-2, from sequence submission to result retrieval.
Strengths
- Supports multiple input modes (sequences, structure files, nanobody-target)
- Seamless OAuth 2.1 integration for authentication
- Automatic file upload and job status tracking
- Nanobody-target cross-model workflow with BoltzGen
Limitations
- Requires a remote MCP server or local setup
- OAuth may need browser interaction on first connection
- Not designed for real-time predictions or very large-scale jobs without adjustments
For any protein structure prediction task from sequences or files, especially complexes or nanobody docking.
For simple single-chain predictions where lighter tools suffice.
Security analysis
CautionThe skill automates a protein structure prediction pipeline using network operations like git clone, adding remote MCP servers, and curl uploads. All actions are transparent and necessary for functionality, with no destructive or obfuscated commands. However, relying on external repositories and servers introduces a moderate degree of trust risk.
- •Instructs cloning a repository from an external GitHub URL.
- •Adds an MCP server from an external HTTP endpoint (Azure app).
- •Reads a local .env file for API keys, but no exfiltration risk.
Examples
Predict the structure of this protein complex: chain A: MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHF, chain B: VHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESF.Do a nanobody docking prediction: nanobody sequence is QVQLVESGGGLVQAGGSLRLSCAASGRTFSYNPMGWFRQAPGKEREFVAAISRSGGSTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAAAGSTWYCQGPGTQVTVSS, target is from file /data/target.pdb.Run boltz2 prediction on the provided structure file /home/user/complex.cif with 5 diffusion samples.name: boltz2-predict version: 1.1.0 description: | Boltz-2 단백질 구조 예측 자동화 스킬. 시퀀스 또는 구조 파일을 입력받아 업로드 → spec 생성 → 검증 → 잡 제출 → 상태 추적까지 전체 워크플로를 자동화한다. 나노바디-타겟 cross-model workflow (boltzgen → Boltz-2) 도 지원. Use when asked to "구조 예측", "structure prediction", "boltz2 실행", "단백질 복합체 예측", "나노바디 구조 예측", "docking prediction". allowed-tools:
- Bash
- Read
- Write
- Agent
/boltz2-predict
Boltz-2 MCP 서버를 통해 단백질 구조 예측 잡을 제출하는 스킬.
설치
git clone https://github.com/SungminKo-smko/boltz2_skill ~/.claude/skills/boltz2-predict
MCP 서버 확인 (run first)
claude mcp list 2>/dev/null | grep boltz2 || echo "NOT_REGISTERED"
NOT_REGISTERED 출력 시 — Streamable HTTP MCP 등록:
claude mcp add boltz2 --transport http https://boltz2-api.politebay-55ff119b.westus3.azurecontainerapps.io/mcp/mcp
OAuth 2.1 인증: HTTP 전송 모드를 사용하면 첫 연결 시 브라우저가 열리며 Google OAuth 로그인이 진행됩니다.
@shaperon.com계정으로 로그인하면 인증이 자동 완료됩니다.
또는 로컬 stdio 모드 (개발용):
cd ~/workspace/boltz2_MSA && source .venv/bin/activate
claude mcp add boltz2 python3 -m boltz2_service.mcp.stdio
Step 0: 인증 확인
OAuth 2.1 자동 인증 (기본): MCP 서버가
--transport http(streamable-http)로 등록되어 있으면 OAuth 2.1 토큰이 자동으로 관리됩니다. 별도의api_key파라미터 없이 모든 도구를 즉시 사용할 수 있습니다.
MCP가 HTTP 모드로 등록되어 있는지 확인:
claude mcp list 2>/dev/null | grep boltz2 || echo "NOT_REGISTERED"
- HTTP 모드로 등록됨 → 인증 완료.
api_key파라미터 생략 가능. Step 1로 바로 이동. - NOT_REGISTERED → 아래 명령으로 등록:
claude mcp add boltz2 --transport http https://boltz2-api.politebay-55ff119b.westus3.azurecontainerapps.io/mcp/mcp
Fallback: .env 파일의 API_KEY (선택사항)
OAuth를 사용할 수 없는 환경(로컬 stdio 모드 등)에서만 필요합니다.
SKILL_ENV="$HOME/.claude/skills/boltz2-predict/.env"
BOLTZ2_API_KEY=""
if [ -f "$SKILL_ENV" ]; then
BOLTZ2_API_KEY=$(grep -E "^API_KEY=" "$SKILL_ENV" | cut -d= -f2-)
fi
[ -z "$BOLTZ2_API_KEY" ] && BOLTZ2_API_KEY="${BOLTZ2_API_KEY:-${API_KEY:-}}"
- 값이 있으면 → tool 호출 시
api_key인수로 전달 - 값이 없고 stdio 모드 →
get_my_api_key()호출로 발급 시도 후.env에 저장 - MCP 미등록 → HTTP 모드 등록을 권장:
claude mcp add boltz2 --transport http https://boltz2-api.politebay-55ff119b.westus3.azurecontainerapps.io/mcp/mcp
Step 1: 입력 모드 판별
사용자 입력을 분석하여 3가지 모드 중 하나를 선택:
모드 A: 시퀀스 기반 예측 (가장 일반적)
- 사용자가 아미노산 시퀀스를 직접 제공한 경우
- FASTA 형식이거나 raw 시퀀스
- → Step 3A로 이동
모드 B: 구조 파일 기반 예측
- 사용자가 .cif 또는 .pdb 파일을 제공한 경우
- → Step 2로 이동 (파일 업로드 필요)
모드 C: 나노바디-타겟 Cross-Model Workflow
- 사용자가 나노바디 시퀀스 + 타겟 구조를 모두 제공한 경우
- 또는 "나노바디 구조 예측", "nanobody docking" 등 키워드
- → Step 2 (타겟 업로드) → Step 3C로 이동
요구사항 수집
사용자가 이미 정보를 제공했으면 묻지 않고 바로 진행.
모드 A 필수:
- 단백질 시퀀스 (1개 이상)
- 각 체인 ID (기본: A, B, C...)
모드 B 필수:
- 구조 파일 경로 (.cif 또는 .pdb)
- 추가 sequence (선택 — 단백질 시퀀스, 리간드 SMILES 등)
모드 C 필수:
- 나노바디 시퀀스
- 타겟 구조 파일 경로 또는 asset_id
공통 선택:
prediction_type— structure (기본), affinity, structure+affinitydiffusion_samples— 기본 1 (1-1000, 100 이상은 앙상블 예측용)output_format— mmcif (기본) 또는 pdb
Step 2: 구조 파일 업로드 (모드 B, C만)
절대 금지: base64 인코딩, Read로 파일 내용 읽기 — 컨텍스트 초과 유발.
create_upload_url로 SAS URL을 받아 curl로 직접 업로드한다.
Claude Desktop 감지
if [ -d "/mnt/user-data/uploads" ]; then
echo "CLAUDE_DESKTOP=true"
ls /mnt/user-data/uploads/
else
echo "CLAUDE_DESKTOP=false"
fi
업로드
create_upload_url(
filename="<파일명>"
# api_key="<BOLTZ2_API_KEY>" # OAuth 연결 시 생략 가능
)
# → asset_id, upload_url, content_type, curl_hint
반환된 curl_hint의 <FILE_PATH>를 실제 경로로 교체 후 Bash 실행:
curl -s -X PUT -T "<절대경로>" \
-H "x-ms-blob-type: BlockBlob" \
-H "Content-Type: <content_type>" \
"<upload_url>"
Step 3A: 시퀀스 기반 Spec 생성 + 잡 제출
YAML spec을 직접 생성하여 검증 + 제출:
validate_spec(
raw_yaml="""version: 1
sequences:
- protein:
id: A
sequence: <시퀀스1>
- protein:
id: B
sequence: <시퀀스2>
""",
asset_ids=[]
# api_key="<BOLTZ2_API_KEY>" # OAuth 연결 시 생략 가능
)
# → spec_id (valid=True 일 때)
검증 성공 시:
submit_job(
spec_id="<spec_id>",
prediction_type="structure",
diffusion_samples=1
# api_key="<BOLTZ2_API_KEY>" # OAuth 연결 시 생략 가능
)
# → job_id
검증 실패 시:
errors내용을 사용자에게 보여주고 수정 안내- 서버에
boltz바이너리가 없으면 503 반환 — 이 경우 검증을 건너뛰고 raw spec으로 직접 제출 불가. 사용자에게 알린다.
Step 3B: 구조 파일 기반 Spec 생성
템플릿 렌더링 (권장)
render_template(
target_asset_id="<asset_id>",
additional_sequences=[
{"protein": {"id": "B", "sequence": "<추가 시퀀스>"}},
# {"ligand": {"id": "L", "smiles": "CCO"}} # 리간드 추가 시
],
constraints=[] # 선택
# api_key="<BOLTZ2_API_KEY>" # OAuth 연결 시 생략 가능
)
# → spec_id, canonical_yaml
Raw YAML (복잡한 케이스)
validate_spec(
raw_yaml="<yaml 문자열>",
asset_ids=["<asset_id>"]
# api_key="<BOLTZ2_API_KEY>" # OAuth 연결 시 생략 가능
)
이후 submit_job으로 제출.
Step 3C: 나노바디-타겟 Cross-Model Workflow
boltzgen에서 디자인한 나노바디 시퀀스를 Boltz-2로 구조 예측:
submit_nanobody_structure_prediction(
nanobody_sequence="<나노바디 시퀀스>",
target_asset_id="<타겟 asset_id>",
nanobody_chain_id="N",
prediction_type="structure",
diffusion_samples=1
# api_key="<BOLTZ2_API_KEY>" # OAuth 연결 시 생략 가능
)
# → job_id, spec_id, status, spec_yaml
이 도구는 spec 생성 + 검증 + 제출을 한 번에 처리한다.
Step 4: 상태 확인
잡 제출 후 바로 상태를 확인하고, running 상태이면 정보를 출력한다:
get_job(job_id="<job_id>")
# api_key는 OAuth 연결 시 생략 가능
출력 예시:
잡 제출 완료!
- Job ID: abc-123-def
- Status: queued → running 대기 중
- 예상 소요시간: 구조 크기에 따라 10분~수 시간 (타임아웃 없음)
상태 확인: get_job(job_id="abc-123-def")
결과 다운로드: get_artifacts(job_id="abc-123-def") (succeeded 후)
Step 5: 결과 확인 및 다운로드
사용자가 결과를 요청하면:
get_job(job_id="<job_id>")
# api_key는 OAuth 연결 시 생략 가능
status == "succeeded"이면:
get_artifacts(job_id="<job_id>")
# → artifacts: {filename: download_url, ...}
# api_key는 OAuth 연결 시 생략 가능
다운로드 URL을 사용자에게 제공하거나, Bash로 다운로드:
curl -o results.zip "<download_url>"
status == "failed"이면:failure_code,failure_message출력status == "running"이면:progress_percent,current_stage출력
잡 관리 도구
# OAuth 연결 시 api_key 생략 가능 (모든 도구 공통)
get_job(job_id) # 상태 확인
get_logs(job_id, tail=100) # 진행 상황 + 로그
list_jobs(status="running") # 잡 목록
cancel_job(job_id) # 잡 취소
list_templates() # 템플릿 목록
list_workers() # 워커 상태
공개 URL (인증 불필요)
MCP 도구 대신 공개 URL로 로그와 상태를 확인할 수 있다. 브라우저에서 직접 열거나 외부 공유 시 활용:
- 로그 스트리밍:
https://boltz2-api.politebay-55ff119b.westus3.azurecontainerapps.io/v1/boltz2/prediction-jobs/<job_id>/logs/public?tail=200 - 로그 텍스트:
https://boltz2-api.politebay-55ff119b.westus3.azurecontainerapps.io/v1/boltz2/prediction-jobs/<job_id>/logs/public/text?tail=50 - 상태 조회:
https://boltz2-api.politebay-55ff119b.westus3.azurecontainerapps.io/v1/boltz2/prediction-jobs/<job_id>/status/public
이메일 알림
잡 상태 변경(queued → running → succeeded/failed) 및 단계 전환 시 Gmail SMTP를 통해 자동으로 이메일 알림이 발송된다. 별도 설정 불필요.
Boltz-2 YAML Spec 레퍼런스
기본 구조 (v1)
version: 1
sequences:
- protein:
id: A
sequence: MKTL...
- protein:
id: B
sequence: EVQL...
Entity 타입
protein — 아미노산 시퀀스
- protein:
id: A # 체인 ID (필수)
sequence: MKTLLILAVL... # 1-letter 아미노산 시퀀스 (필수)
cif — 기존 구조 파일
- cif:
path: targets/input.cif # 업로드된 파일 경로
ligand — 소분자 (SMILES 또는 CCD 코드)
- ligand:
id: L
smiles: 'CCO' # SMILES 표기
# ccd: ATP # 또는 CCD 코드
Constraints (선택)
constraints:
- bond:
atom1: [A, 1, CA] # [chain, residue, atom]
atom2: [B, 50, CA]
prediction_type 옵션
| 값 | 설명 |
|----|------|
| structure | 기본 구조 예측 |
| affinity | 결합 친화도 예측 |
| structure+affinity | 구조 + 친화도 동시 |
| virtual_screening | 가상 스크리닝 |
runtime_options 주요 파라미터
| 파라미터 | 기본값 | 범위 | 설명 |
|----------|--------|------|------|
| diffusion_samples | 1 | 1-1000 | 디퓨전 샘플 수 (많을수록 다양한 구조, 100+ 앙상블) |
| max_parallel_samples | 5 | 1-100 | GPU에서 동시 처리할 샘플 수 (OOM 시 낮춤) |
| sampling_steps | 200 | 50-1000 | 샘플링 스텝 |
| recycling_steps | 3 | 1-10 | 리사이클링 스텝 |
| output_format | mmcif | pdb/mmcif | 출력 형식 |
| use_msa_server | true | - | MSA 서버 사용 여부 |
| use_potentials | false | - | 에너지 기반 가이드 |
BoltzGen 통합 (Cross-Service)
boltz2와 boltzgen은 동일한 Supabase 인증 시스템(nanomapAIDEN 프로젝트)을 공유한다.
boltz2 API KEY를 이미 발급받은 사용자는 동일한 로그인(/auth/login, /auth/callback, /auth/device-code)으로 boltzgen용 KEY도 별도 발급받을 수 있다.
- 두 서비스 모두
b2_접두사를 사용하지만 KEY는 서비스별로 분리됨 - boltz2 KEY는 boltz2에서만, boltzgen KEY는 boltzgen에서만 유효
- 인증 엔드포인트 패턴은 동일:
/auth/login,/auth/callback,/auth/device-code
오류 처리
- 인증 실패 (OAuth): MCP가 HTTP 모드로 등록되어 있는지 확인. 브라우저 OAuth 로그인 재시도.
- API_KEY 미설정 (fallback): OAuth를 사용할 수 없는 환경에서만 해당.
~/.claude/skills/boltz2-predict/.env에API_KEY=<key>추가 - MCP 미등록:
claude mcp add boltz2 --transport http <URL>실행 - 503 boltz2 binary not available: 서버에 boltz 바이너리가 설치되지 않음. 검증 불가.
- 401 인증 실패: API KEY 확인
- 429 Rate limit: 일일 한도(20) 또는 동시 한도(5) 초과
- 잡 실패:
get_job의failure_code확인boltz2_run_failed— Boltz-2 실행 오류worker_timeout— 워커 heartbeat 없음 (list_workers로 상태 확인)
API 엔드포인트 (REST 직접 호출 시)
Base URL: https://boltz2-api.politebay-55ff119b.westus3.azurecontainerapps.io
| Method | Path | 설명 |
|--------|------|------|
| GET | /healthz | 헬스체크 |
| GET | /auth/login | Google OAuth 시작 |
| POST | /auth/device-code | Device Auth 코드 발급 |
| POST | /v1/boltz2/uploads | 업로드 URL 생성 |
| GET | /v1/boltz2/spec-templates | 템플릿 목록 |
| POST | /v1/boltz2/spec-templates/render | Spec 렌더링 |
| POST | /v1/boltz2/specs/validate | Spec 검증 |
| POST | /v1/boltz2/prediction-jobs | 잡 제출 |
| GET | /v1/boltz2/prediction-jobs | 잡 목록 |
| GET | /v1/boltz2/prediction-jobs/{id} | 잡 상세 |
| POST | /v1/boltz2/prediction-jobs/{id}:cancel | 잡 취소 |
| GET | /v1/boltz2/prediction-jobs/{id}/artifacts | 결과 다운로드 |
| GET | /v1/boltz2/prediction-jobs/{id}/logs/public | 공개 로그 스트리밍 (인증 불필요) |
| GET | /v1/boltz2/prediction-jobs/{id}/logs/public/text | 공개 로그 텍스트 (인증 불필요) |
| GET | /v1/boltz2/prediction-jobs/{id}/status/public | 공개 상태 조회 (인증 불필요) |
| GET | /docs | Swagger UI |
Prompt Engineering
Data & AI
Prompt engineering best practices and templates to maximize AI outputs.
Data Visualization
Data & AI
Generates data visualizations and charts tailored to your data.
RAG Architecture Setup
Data & AI
Setup guide for RAG (Retrieval-Augmented Generation) architectures.