Schémas Effect avec Vérification de Parité de Type

Définir et vérifier des schémas Effect alignés avec les types de domaine TypeScript. Utilise satisfies, tsafe Equals et des assertions pour garantir la parité entre schémas et types.

Spar Skills Guide Bot
DeveloppementIntermédiaire0 vues0 installations02/03/2026
Claude CodeCursorWindsurfCopilot
typescripteffect-schematype-safetyvalidationzerospin

name: effect-schema description: Define Effect schemas that are verified against domain types. Use when authoring or updating Effect Schema definitions, or when the user mentions schema/type parity, satisfies, or tsafe Equals checks.

Effect Schema Type Parity

Instructions

  • Define the domain type first (prefer interface), then define the schema and assert parity.
  • Always use satisfies Schema.Schema<YourType, any> on the schema.
  • Add assert<Equals<typeof YourSchema.Type, Readonly<YourType>>>() using tsafe.
  • If the assert<Equals<...>> isn't typed correctly but the satisfies is, you can optionally add the _check1/_check2 assignments with void (see ZerospinCommandSchema).
  • When validating unknown input against an Effect schema, prefer validateUnknown from zerospin if available.

Example

import type { Equals } from 'tsafe';

import { Schema } from 'effect';
import { assert } from 'tsafe';

export interface IFoo {
  bar: string;
}

export const ZFoo = Schema.Struct({
  bar: Schema.String,
}) satisfies Schema.Schema<IFoo, any>;

const _check1: typeof ZFoo.Type = {} as IFoo;
const _check2: IFoo = {} as typeof ZFoo.Type;
void _check1;
void _check2;
assert<Equals<typeof ZFoo.Type, Readonly<IFoo>>>();

Skills similaires